General Information

  • ID:  hor004347
  • Uniprot ID:  Q868G6
  • Protein name:  Brain peptide EILDEI
  • Gene name:  Atk
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  Strong expression was detected in the queen and forager heads, while weak and almost no significant expression was detected in the nurse and drone heads, respectively.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007610 behavior
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  EILDEI
  • Length:  6
  • Propeptide:  MIIHSIFLLMVSITLVIAEESDNVLFDKRAPTGHQEMQGKQNSASLNSENFGIFKRALMGFQGVRGKKNSIINDVKNELFPEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGKKSLEEILDEIKKKTTRFQDSRSKDVYLIDYPEDYGKRVLSMDGYQNILDKKDELLGEWEKRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFKRARMGFHGMRGKRDAAGIYGSNSSTVGTIFGYQDMRNRGNNFPVYQVEKRSPFRYLGARGKKNPRWEFRGKFVGVRGKKSSLQTVF
  • Signal peptide:  MIIHSIFLLMVSITLVIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be active peptides which excite neurons, evoke behavioral responses, be potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q868G6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004347_AF2.pdbhor004347_ESM.pdb

Physical Information

Mass: 82019 Formula: C32H54N6O13
Absent amino acids: ACFGHKMNPQRSTVWY Common amino acids: EI
pI: 3.42 Basic residues: 0
Polar residues: 0 Hydrophobic residues: 3
Hydrophobicity: 38.33 Boman Index: -758
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 195
Instability Index: 10463.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain